settings Currency keyboard_arrow_down
GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
menu
phoneemail
shopping_cart Basket (0)
Special Offers
location_on
Ladies Fitness Capri Pants by Corex
Ladies Fitness Capri Pants by Corex Ladies Fitness Capri Pants by Corex

Ladies Fitness Capri Pants by Corex

Product Code:  QSMmkmE
Product Description
Capri Pants from COREX
Designed for multi-sports and general gymwear, the Capri Pants are extremely comfortable and breathable, making them great for high impact activities.
With reinforced stitching, the Capris are made from a highly breathable, stretch fabric for unrestricted movement whatever your workout.
These Capri pants are designed to give a tight and supporting fit.
When used during workouts, they can assist in reducing fatigue.
Our Capri Pants have a doubled waistband to add support and improve comfort during use.
  • CoreX Logo in Silver
  • Screen Printed branding which wont crack, fade or peel
  • High stretch fabric
  • Built in sports bra style support
  • High stretch fabric for unrestricted movement
  • Great for gym wear or general sportswear


PLEASE NOTE;
At the moment postage is mainland UK 2nd class signed for, thank you.
£15.00 inc. tax
Add to Cart Quantity
Product Details
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Description
No Reviews Posted Yet - be the first! write review
Related Products
Featured Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i